Structure of 1zkd: Difference between revisions
From MDWiki
Jump to navigationJump to search
No edit summary |
No edit summary |
||
Line 38: | Line 38: | ||
==Information on 1zkd== | ==Information on 1zkd== | ||
http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZKD | [http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZKD 1zkd] | ||
Located on 2p22.2 on human chromosome with 441 aa | Located on 2p22.2 on human chromosome with 441 aa | ||
Line 46: | Line 46: | ||
DUF185 domain identified by Pfam | DUF185 domain identified by Pfam | ||
[http://www.rcsb.org/pdb/explore/explore.do?structureId=2EX4 Nearest match - 2ex4] | |||
Most probably a transferase as most of the matches from DALI are transferase | Most probably a transferase as most of the matches from DALI are transferase | ||
[http://www.ebi.ac.uk/cgi-bin/iprscan/iprscan?tool=iprscan&jobid=iprscan-20070508-06423459 Interpro Results] | |||
Revision as of 05:14, 15 May 2007
Sequence
MIDQTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQ TLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGIRNIHWHDSFEDVPEGPAVILANEYFD VLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTEILKIASRVRDQGGAALI IDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQGAFLKRLGIETRALSLMAKA TPQVSEDIAGALQRLTGEGRGAMGSMFKVIGVSDPKIETLVALSDDTDREAERRQGTHGLEHHHHHH
Information on 1zkd
Located on 2p22.2 on human chromosome with 441 aa
Located on 17E3 on mouse chromosome with 436 aa
DUF185 domain identified by Pfam
Most probably a transferase as most of the matches from DALI are transferase
SUMMARY: PDB/chain identifiers and structural alignment statistics
NR. STRID1 STRID2 Z RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN 1: 3027-A 1zkd-A 56.8 0.0 349 349 100 0 0 1 S STRUCTURAL GENOMICS, UNKNOWN FUNCTION duf185 (rhodops 2: 3027-A 2ex4-A 11.7 3.0 185 221 12 0 0 22 S TRANSFERASE adrenal gland protein ad-003 (homo sapien 3: 3027-A 1im8-A 11.6 3.2 178 225 10 0 0 18 S TRANSFERASE yeco (methyltransferase, hypothetical pro 4: 3027-A 2gb4-A 10.8 3.3 184 231 13 0 0 19 S TRANSFERASE thiopurine s-methyltransferase (thiopurine 5: 3027-A 2fk7-A 10.7 3.8 186 277 14 0 0 19 S TRANSFERASE methoxy mycolic acid synthase 4 (mycobact 6: 3027-A 2ob1-A 10.2 3.9 196 319 9 0 0 23 S TRANSFERASE leucine carboxyl methyltransferase 1 (prot 7: 3027-A 2f8l-A 10.0 3.7 182 318 8 0 0 22 S STRUCTURAL GENOMICS, UNKNOWN FUNCTION hypothetical pro 8: 3027-A 2avn-A 10.0 3.7 183 242 11 0 0 20 S STRUCTURAL GENOMICS, UNKNOWN FUNCTION ubiquinoneMENAQU 9: 3027-A 2bzg-A 9.9 3.4 182 226 13 0 0 20 S TRANSFERASE thiopurine s-methyltransferase (thiopurine 10: 3027-A 2aot-A 9.8 4.3 182 285 13 0 0 23 S TRANSFERASE histamine n-methyltransferase (hmt) (homo 11: 3027-A 2p8j-A 9.7 3.4 168 203 10 0 0 16 S TRANSFERASE s-adenosylmethionine-dependent methyltrans 12: 3027-A 1vl5-A 9.7 3.3 167 225 9 0 0 18 S STRUCTURAL GENOMICS, UNKNOWN FUNCTION unknown conserve 13: 3027-A 1hnn-A 9.7 3.4 183 261 13 0 0 18 S TRANSFERASE phenylethanolamine n-methyltransferase (p 14: 3027-A 1m6e-X 9.6 3.6 206 359 9 0 0 27 S TRANSFERASE s-adenosyl-l-methionnine:salicylic acid ca 15: 3027-A 2fay-A 9.5 3.9 178 274 14 0 0 21 S 16: 3027-A 2h00-A 9.2 2.9 158 225 9 0 0 18 S TRANSFERASE methyltransferase 10 domain containing pro 17: 3027-A 1wy7-A 9.2 3.1 155 195 13 0 0 15 S TRANSFERASE hypothetical protein ph1948 (pyrococcus h 18: 3027-A 1m6y-A 8.8 4.3 156 289 10 0 0 19 S TRANSFERASE s-adenosyl-methyltransferase mraw (thermo 19: 3027-A 1i9g-A 8.7 3.0 149 264 9 0 0 15 S TRANSFERASE hypothetical protein rv2118c (mycobacter 20: 3027-A 1zq9-A 8.6 3.2 144 278 16 0 0 19 S TRANSFERASE probable dimethyladenosine transferase (s-