Structure of 1zkd: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
No edit summary
Line 49: Line 49:


[http://www.rcsb.org/pdb/explore/explore.do?structureId=1IM8 2nd nearest match - 1im8]
[http://www.rcsb.org/pdb/explore/explore.do?structureId=1IM8 2nd nearest match - 1im8]
http://cl.sdsc.edu/ce_scratch/ce2162.html


Most probably a transferase as most of the matches from DALI are transferase
Most probably a transferase as most of the matches from DALI are transferase

Revision as of 05:35, 15 May 2007


Sequence

MIDQTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQ TLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGIRNIHWHDSFEDVPEGPAVILANEYFD VLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTEILKIASRVRDQGGAALI IDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQGAFLKRLGIETRALSLMAKA TPQVSEDIAGALQRLTGEGRGAMGSMFKVIGVSDPKIETLVALSDDTDREAERRQGTHGLEHHHHHH

1zkd














Information on 1zkd

1zkd

Located on 2p22.2 on human chromosome with 441 aa

Located on 17E3 on mouse chromosome with 436 aa

DUF185 domain identified by Pfam

Nearest match - 2ex4

2nd nearest match - 1im8

http://cl.sdsc.edu/ce_scratch/ce2162.html

Most probably a transferase as most of the matches from DALI are transferase

Interpro Results


DALI Results

SUMMARY: PDB/chain identifiers and structural alignment statistics

NR. STRID1 STRID2  Z   RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
 1: 3027-A 1zkd-A 56.8  0.0  349   349  100      0      0     1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops
 2: 3027-A 2ex4-A 11.7  3.0  185   221   12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien
 3: 3027-A 1im8-A 11.6  3.2  178   225   10      0      0    18 S     TRANSFERASE     yeco (methyltransferase, hypothetical pro
 4: 3027-A 2gb4-A 10.8  3.3  184   231   13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
 5: 3027-A 2fk7-A 10.7  3.8  186   277   14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4         (mycobact
 6: 3027-A 2ob1-A 10.2  3.9  196   319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
 7: 3027-A 2f8l-A 10.0  3.7  182   318    8      0      0    22 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    hypothetical pro
 8: 3027-A 2avn-A 10.0  3.7  183   242   11      0      0    20 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    ubiquinoneMENAQU
 9: 3027-A 2bzg-A  9.9  3.4  182   226   13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
10: 3027-A 2aot-A  9.8  4.3  182   285   13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)     (homo
11: 3027-A 2p8j-A  9.7  3.4  168   203   10      0      0    16 S    TRANSFERASE      s-adenosylmethionine-dependent methyltrans
12: 3027-A 1vl5-A  9.7  3.3  167   225    9      0      0    18 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    unknown conserve
13: 3027-A 1hnn-A  9.7  3.4  183   261   13      0      0    18 S     TRANSFERASE     phenylethanolamine n-methyltransferase (p
14: 3027-A 1m6e-X  9.6  3.6  206   359    9      0      0    27 S    TRANSFERASE      s-adenosyl-l-methionnine:salicylic acid ca
15: 3027-A 2fay-A  9.5  3.9  178   274   14      0      0    21 S
16: 3027-A 2h00-A  9.2  2.9  158   225    9      0      0    18 S    TRANSFERASE      methyltransferase 10 domain containing pro
17: 3027-A 1wy7-A  9.2  3.1  155   195   13      0      0    15 S    TRANSFERASE      hypothetical protein ph1948     (pyrococcus h
18: 3027-A 1m6y-A  8.8  4.3  156   289   10      0      0    19 S    TRANSFERASE      s-adenosyl-methyltransferase mraw       (thermo
19: 3027-A 1i9g-A  8.7  3.0  149   264    9      0      0    15 S     TRANSFERASE     hypothetical protein rv2118c    (mycobacter
20: 3027-A 1zq9-A  8.6  3.2  144   278   16      0      0    19 S    TRANSFERASE      probable dimethyladenosine transferase (s-