DAP Structural Analysis: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
No edit summary
Line 61: Line 61:


Jmol picture taken with functional motif H(82)T(83)D(84) site.
Jmol picture taken with functional motif H(82)T(83)D(84) site.
Amino acids involved in the catalytic mechanism of M18metallopeptidases are unknown, although histidines are likely involved in Zn2+ coordination (Wilk .et, al. 2002). Above shown is the histidine site at poisition 82 in the sequence and it is conserved in structural alignment with the other three proteins that are marked out in the DALI search. From literature review papers, the following results have been deduced and dicuss in the discussion.

Revision as of 17:00, 5 June 2008

Chain Sequence of 2ijz-A

>gi|119390187|pdb|2IJZ|A Chain A, Crystal Structure Of Aminopeptidase RAELNQGLIDFLKASPTPFHATASLARRLEAAGYRRLDERDAWHTETGGRYYVTRNDSSLIAIRLGRRSP LESGFRLVGAHTDSPCLRVKPNPEIARNGFLQLGVEVYGGALFAPWFDRDLSLAGRVTFRANGKLESRLV DFRKAIAVIPNLNIHLNRAANEGWPINAQNELPPIIAQLAPGEAADFRLLLDEQLLREHGITADVVLDYE LSFYDTQSAAVVGLNDEFIAGARLDNLLSCHAGLEALLNAEGDENCILVCTDHEEVGSCSHCGADGPFLE QVLRRLLPEGDAFSRAIQRSLLVSADNAHGVHPNYADRHDANHGPALNGGPVIKINSNQRYATNSETAGF FRHLCQDSEVPVQSFVTRSDMGCGSTIGPITASQVGVRTVDIGLPTFAMHSIRELAGSHDLAHLVKVLGA FYASSELP

Structure of 2ijz-A chain

PDBsum.JPG

Fig x: PDBsum Analysis of the secondary protein sequence giving rise to how the protein folds in the motifs of turns and hairpins.

Topology.JPG

Fig x: Topology of 2ijz-A chain giving a simplified understanding of how the protein folds.

Structural Analysis of 2ijz-A chain

2ijz-A.JPG

Fig x: A) Front view of 2ijz-A chain structure; B) Back view of 2ijz-A –chain Structure; Pictures showing the loops (pink), beta-sheet (magenta) and alpha helix (greenish blue) of the structure taken from PyMOL.

Dali Results.JPG

Fig X: Part of DALI search results gathering structurally related proteins. The three marked proteins in orange were structurally aligned using PyMOL. Proteins 13 to 18 were not taken as no scientific evidence of the protein has been obtained yet.

From here, the results of the conserved regions in the sequence is taken from the evolutionary analysis part. These conserved regions are then marked out in red in the following image below (Fig:X).

Positions of conserved regions

Conserved regions.JPG

Conserved regions of 2ijz-A.JPG

Fig X: Structure of 2ijz-A with conserved regions colored in red.

Structural Comparison of 2ijz-A and Respective Proteins

Comparison 2ijz and 1vhe.JPG

Comparison of 2ijz-A chain (yellow) and 1vhe-A chain (blue) and both of the similar conserved regions are marked in red.

Comparison 2ijz and 1xfo3.JPG

Comparison of 2ijz-A chain (yellow) and 1xfo-A chain (blue) and both of the similar conserved regions are marked in red.

Comparison 2ijz and 2cf4.JPG

Comparison of 2ijz-A chain (yellow) and 2cf4-A chain (blue) and both of the similar conserved regions are marked in red.

http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/profunc/GetResults.pl?source=profunc&user_id=bx52&code=035241

Jmol analyse of H82site2.JPG

Jmol picture taken with functional motif H(82)T(83)D(84) site.

Amino acids involved in the catalytic mechanism of M18metallopeptidases are unknown, although histidines are likely involved in Zn2+ coordination (Wilk .et, al. 2002). Above shown is the histidine site at poisition 82 in the sequence and it is conserved in structural alignment with the other three proteins that are marked out in the DALI search. From literature review papers, the following results have been deduced and dicuss in the discussion.